PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G093800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 303aa    MW: 33889.1 Da    PI: 6.6941
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G093800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.11.1e-4171061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC ++Cv+apyfp +qp+kf +vhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+ql
  Manes.12G093800.1.p   7 PCAACKFLRRKCIQECVFAPYFPPDQPQKFSCVHKVFGASNVAKLLNELNASQREDAVNSLAYEAEERLRDPVYGCVGLISILQHRLKQL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++l  +k+e
  Manes.12G093800.1.p  97 QNDLYIAKRE 106
                          ***9988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.376107IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-417103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCIQ ECVFAPYFPP DQPQKFSCVH KVFGASNVAK LLNELNASQR  60
EDAVNSLAYE AEERLRDPVY GCVGLISILQ HRLKQLQNDL YIAKRELAGY IGPSAMLPIL  120
QNPTYMPQQH LGNPSSSNVI PYNMLPMMGI PTGPPHGGQL MIREHPQQHP THPQQQFFEA  180
QQLADAVVVR DQQEMFRTYD QQQPEDQSQH HQELVRYNSG FDAAGLVTAT GYNQLSVASA  240
MSPSLALGIY DNPYQIQQTA HPHHQLQEQL LLQPQQQQPP QLTQQQHQRS GNEEGRSVGP  300
SC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079177.11e-128PREDICTED: LOB domain-containing protein 36-like
RefseqXP_012079178.11e-128PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-88LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-133A0A0B0PS92_G
STRINGPOPTR_0007s11460.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-85ASYMMETRIC LEAVES 2-like 1